[KD Validated] NQO1 Rabbit mAb (A19586)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KD Validated] NQO1 Rabbit mAb
Catalog No.	A19586
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56753

Background

This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NQO1 (P15559).
Sequence	MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIF
Gene ID
Swiss Prot
Synonyms	DTD; QR1; DHQU; DIA4; NMOR1; NMORI
Calculated MW	31kDa
Observed MW	31kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IF/ICC
Recommended dilution	WB 1:5000 - 1:20000 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Hep G2, HeLa, Mouse Stomach, Rat Lung, Rat Stomach
Cellular location	Cytoplasm
Customer validation	WB(Mus musculus, Homo sapiens, Vaccinium dunalianum, Bovini, Rattus norvegicus) IF(Mus musculus) IHC(Mus musculus) RT-qPCR(Homo sapiens)

Western blot analysis of extracts of various lysates, using NQO1 antibody (A19586) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts from wild type (WT) and NQO1 knockdown (KD) HeLa cells, using NQO1 antibody (A19586) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunofluorescence analysis of Rat stomach using NQO1 antibody (A19586) at dilution of 1:300 (40x lens).Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Mouse stomach using NQO1 antibody (A19586) at dilution of 1:300 (40x lens).Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NQO1 (P15559).
Isotype	IgG