быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TRAF6BP/TAX1BP1 Rabbit mAb (A19587)
- Описание
- Характеристики
-
Overview
Product name TRAF6BP/TAX1BP1 Rabbit mAb Catalog No. A19587 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2184 Background
This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated with apoptosis induced by TNF. This protein may also have a role in the inhibition of inflammatory signaling pathways. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 690-789 of human TRAF6BP/TAX1BP1 (Q86VP1). Sequence DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD Gene ID Swiss Prot Synonyms T6BP; TXBP151; CALCOCO3 Calculated MW 91kDa Observed MW 100kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, U-937, U-251MG, Mouse testis Cellular location Cytosol, Extracellular exosome 
Western blot analysis of extracts of various cell lines, using TRAF6BP/TAX1BP1 Rabbit mAb (A19587) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 690-789 of human TRAF6BP/TAX1BP1 (Q86VP1). Isotype IgG