быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Y14/RBM8A Rabbit mAb (A19599)
- Описание
- Характеристики
-
Overview
Product name Y14/RBM8A Rabbit mAb Catalog No. A19599 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2189 Background
This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Y14/RBM8A (Q9Y5S9). Sequence MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIK Gene ID Swiss Prot Synonyms TAR; Y14; RBM8; ZNRP; RBM8B; ZRNP1; BOV-1A; BOV-1B; BOV-1C; MDS014; DEL1q21.1; C1DELq21.1 Calculated MW 20kDa Observed MW 20kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, 293T, Jurkat, Mouse lung, Mouse brain, Rat lung, Rat brain, Rat spleen Cellular location cytoplasm, cytosol, nuclear speck, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using Y14/RBM8A Rabbit mAb (A19599) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Y14/RBM8A (Q9Y5S9). Isotype IgG







