![[KD Validated] ATG7 Rabbit mAb (A19604)](/upload/resize_cache/iblock/451/340_340_140cd750bba9870f18aada2478b24840a/7v61mxogm0le05z3niaz4rh2cprjnj4l.jpg "[KD Validated] ATG7 Rabbit mAb (A19604)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] ATG7 Rabbit mAb (A19604)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] ATG7 Rabbit mAb Catalog No. A19604 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0083 Background
This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). Sequence MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD Gene ID Swiss Prot Synonyms GSA7 Calculated MW 78kDa Observed MW 77kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, THP-1, 293T, Mouse brain, Mouse lung, Mouse spleen, Rat testis Cellular location Cytoplasm, Preautophagosomal structure Customer validation IP(Homo sapiens)
WB(Mus musculus, Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using ATG7 antibody (A19604) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and ATG7 knockout (KD) HeLa cells, using ATG7 antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: ARC0083.
Immunohistochemistry analysis of paraffin-embedded rat spleen using ATG7 antibody (A19604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using ATG7 antibody (A19604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). Isotype IgG