быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACC1 Rabbit mAb (A19627)
- Описание
- Характеристики
-
Overview
Product name ACC1 Rabbit mAb Catalog No. A19627 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2201 Background
Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ACC1 (Q13085). Sequence RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE Gene ID Swiss Prot Synonyms ACC; ACAC; ACC1; ACCA; Acac1; hACC1; ACACAD; ACCalpha; ACACalpha Calculated MW 266kDa Observed MW 277kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, HepG2, C6, Mouse heart Cellular location actin cytoskeleton, cytosol, fibrillar center, mitochondrion Customer validation WB(Homo sapiens, Mus musculus)
Western blot analysis of extracts of various cell lines, using ACC1 Rabbit mAb (A19627) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Mouse heart, using ACC1 Rabbit mAb (A19627) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded mouse testis using ACC1 Rabbit mAb (A19627) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using ACC1 Rabbit mAb (A19627) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg ACC1 antibody (A19627). Western blot was performed from the immunoprecipitate using ACC1 (A19627) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ACC1 (Q13085). Isotype IgG