[KD Validated] Casein Kinase 2 alpha (CSNK2A1) Rabbit mAb (A19683)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KD Validated] Casein Kinase 2 alpha (CSNK2A1) Rabbit mAb
Catalog No.	A19683
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0163

Background

Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythm. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. Multiple transcript variants encoding different protein isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (CSNK2A1) (P68400).
Sequence	MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
Gene ID
Swiss Prot
Synonyms	CKII; Cka1; Cka2; CK2A1; OCNDS
Calculated MW	45kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, BT-474, SW620
Cellular location	Nucleus
Customer validation	(Human lung cancer cell-H460)

Western blot analysis of various lysates, using Casein Kinase 2 alpha (CSNK2A1) antibody (A19683) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of extracts from wild type(WT) and Casein Kinase 2 alpha (CSNK2A1) knockdown (KD) 293T cells, using Casein Kinase 2 alpha (CSNK2A1) antibody (A19683) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (CSNK2A1) (P68400).
Isotype	IgG