быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Transportin 3 (TNPO3) Rabbit mAb (A19774)
- Описание
- Характеристики
-
Overview
Product name Transportin 3 (TNPO3) Rabbit mAb Catalog No. A19774 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2310 Background
The protein encoded by this gene is a nuclear import receptor for serine/arginine-rich (SR) proteins such as the splicing factors SFRS1 and SFRS2. The encoded protein has also been shown to be involved in HIV-1 infection, apparently through interaction with the HIV-1 capsid protein. Several protein-coding and non-coding transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (Transportin 3 (TNPO3)) (Q9Y5L0). Sequence QVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLFR Gene ID Swiss Prot Synonyms IPO12; TRNSR; LGMD1F; LGMDD2; MTR10A; TRN-SR; TRN-SR2 Calculated MW 104kDa Observed MW 104kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, RD, Jurkat, Mouse lung, Mouse testis, Mouse thymus, Rat testis Cellular location Cytoplasm, Nuclear envelope 
Western blot analysis of extracts of various cell lines, using Transportin 3 (Transportin 3 (TNPO3)) Rabbit mAb (A19774) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using Transportin 3 (Transportin 3 (TNPO3)) Rabbit mAb (A19774) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Transportin 3 (Transportin 3 (TNPO3)) Rabbit mAb (A19774) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using Transportin 3 (Transportin 3 (TNPO3)) Rabbit mAb (A19774) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using Transportin 3 (Transportin 3 (TNPO3)) Rabbit mAb (A19774) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (Transportin 3 (TNPO3)) (Q9Y5L0). Isotype IgG