быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZBTB7A/FBI-1/LRF Rabbit mAb (A19785)
- Описание
- Характеристики
-
Overview
Product name ZBTB7A/FBI-1/LRF Rabbit mAb Catalog No. A19785 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2320 Background
Enables several functions, including SMAD binding activity; androgen receptor binding activity; and transcription corepressor binding activity. Involved in several processes, including erythrocyte maturation; negative regulation of signal transduction; and regulation of nucleobase-containing compound metabolic process. Located in cytoplasm and nucleus. Colocalizes with DNA-dependent protein kinase complex and NuRD complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ZBTB7A/FBI-1/LRF (O95365). Sequence NYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASP Gene ID Swiss Prot Synonyms LRF; FBI1; FBI-1; TIP21; ZBTB7; MNDLFH; ZNF857A; pokemon Calculated MW 61kDa Observed MW 70kDa Applications
Reactivity Human Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:1000 - 1:3000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HT-29, MCF7 Cellular location nucleus 
Western blot analysis of extracts of various cell lines, using ZBTB7A/FBI-1/LRF Rabbit mAb (A19785) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ZBTB7A/FBI-1/LRF Rabbit mAb (A19785) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of U-2 OS cells using ZBTB7A/FBI-1/LRF Rabbit mAb (A19785) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ZBTB7A/FBI-1/LRF (O95365). Isotype IgG