быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
YKL-40/CHI3L1 Rabbit mAb (A20792)
- Описание
- Характеристики
-
Overview
Product name YKL-40/CHI3L1 Rabbit mAb Catalog No. A20792 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51312 Background
Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 284-383 of human YKL-40/CHI3L1 (NP_001267.2). Sequence PGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT Gene ID Swiss Prot Synonyms GP39; ASRT7; GP-39; YK-40; YKL40; CGP-39; YKL-40; YYL-40; HC-gp39; HCGP-3P; hCGP-39 Calculated MW 43kDa Observed MW 30-43kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples THP-1, U-87MG, Mouse lung Cellular location Cytoplasm, Endoplasmic reticulum, Secreted, extracellular space, perinuclear region 
Western blot analysis of extracts of THP-1 cells, using YKL-40/CHI3L1 antibody (A20792) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using YKL-40/CHI3L1 antibody (A20792) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of THP-1 cells and K-562 cells using YKL-40/CHI3L1 Rabbit mAb (A20792) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of THP-1 and K-562 cells using YKL-40/CHI3L1 Rabbit mAb (A20792) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 284-383 of human YKL-40/CHI3L1 (NP_001267.2). Isotype IgG