быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
UBA52 Rabbit mAb (A20876)
- Описание
- Характеристики
-
Overview
Product name UBA52 Rabbit mAb Catalog No. A20876 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2817 Background
Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus, a C-terminal extension protein (CEP). Multiple processed pseudogenes derived from this gene are present in the genome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBA52 (P62987). Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCY Gene ID Swiss Prot Synonyms L40; CEP52; RPL40; HUBCEP52 Calculated MW 15kDa Observed MW 10kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples MCF7, PC-3, U-937, Mouse liver, Mouse testis, Mouse kidney, Rat liver, Rat testis Cellular location cytoplasm, cytosol, cytosolic ribosome, endoplasmic reticulum, extracellular exosome, extracellular space, mitochondrial outer membrane, nucleoplasm, nucleus, plasma membrane Customer validation WB(Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using UBA52 antibody (A20876) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded human brain using UBA52 Rabbit mAb (A20876) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse liver using UBA52 Rabbit mAb (A20876) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat ovary using UBA52 Rabbit mAb (A20876) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using UBA52 Rabbit mAb (A20876) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using UBA52 Rabbit mAb (A20876) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using UBA52 Rabbit mAb (A20876) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using UBA52 Rabbit mAb (A20876) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBA52 (P62987). Isotype IgG