быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TRAPPC2 Rabbit mAb (A20890)
- Описание
- Характеристики
-
Overview
Product name TRAPPC2 Rabbit mAb Catalog No. A20890 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2843 Background
The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAPPC2 (P0DI81). Sequence MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFT Gene ID Swiss Prot Synonyms SEDL; SEDT; MIP2A; TRS20; ZNF547L; hYP38334; TRAPPC2P1 Calculated MW 16kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples SKOV3, PC-3, SH-SY5Y, Mouse brain, Mouse thymus, Rat brain Cellular location Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Nucleus, perinuclear region 
Western blot analysis of extracts of various cell lines, using TRAPPC2 antibody (A20890) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human small intestine using TRAPPC2 Rabbit mAb (A20890) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using TRAPPC2 Rabbit mAb (A20890) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using TRAPPC2 Rabbit mAb (A20890) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAPPC2 (P0DI81). Isotype IgG