быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TPMT Rabbit mAb (A20922)
- Описание
- Характеристики
-
Overview
Product name TPMT Rabbit mAb Catalog No. A20922 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2897 Background
This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals, causing thiopurine S-methyltransferase deficiency. Related pseudogenes have been identified on chromosomes 3, 18 and X.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TPMT (P51580). Sequence KKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIW Gene ID Swiss Prot Synonyms TPMTD Calculated MW 28kDa Observed MW 28-32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Hep G2, K-562, Mouse liver, Mouse brain, Mouse kidney, Rat liver, Rat kidney Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using TPMT antibody (A20922) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TPMT (P51580). Isotype IgG