быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACADS / SCAD Rabbit mAb (A20926)
- Описание
- Характеристики
-
Overview
Product name ACADS / SCAD Rabbit mAb Catalog No. A20926 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2901 Background
This gene encodes a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with short-chain acyl-CoA dehydrogenase (SCAD) deficiency. Alternative splicing results in two variants which encode different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 313-412 of human ACADS / SCAD (P16219). Sequence KLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS Gene ID Swiss Prot Synonyms SCAD; ACAD3 Calculated MW 44kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Jurkat, Mouse liver, Mouse skeletal muscle, Mouse heart, Rat liver, Rat skeletal muscle, Rat heart Cellular location Mitochondrion matrix 
Western blot analysis of extracts of various cell lines, using ACADS/SCAD antibody (A20926) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ACADS / SCAD Rabbit mAb (A20926) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using ACADS / SCAD Rabbit mAb (A20926) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using ACADS / SCAD Rabbit mAb (A20926) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 313-412 of human ACADS / SCAD (P16219). Isotype IgG