быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TSFM Rabbit mAb (A20936)
- Описание
- Характеристики
-
Overview
Product name TSFM Rabbit mAb Catalog No. A20936 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2918 Background
This gene encodes a mitochondrial translation elongation factor. The encoded protein is an enzyme that catalyzes the exchange of guanine nucleotides on the translation elongation factor Tu during the elongation step of mitchondrial protein translation. Mutations in this gene are associated with combined oxidative phosphorylation deficiency-3 syndrome. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TSFM (P43897). Sequence MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGR Gene ID Swiss Prot Synonyms EFTS; EFTSMT Calculated MW 35kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
- IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples 293T, Hep G2, HeLa, RAW 264.7, Mouse heart, Rat liver Cellular location Mitochondrion 
Western blot analysis of various lysates, using TSFM Rabbit mAb (A20936) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of HeLa cells using TSFM Rabbit mAb (A20936) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300ug extracts from 293T cells using 3ug TSFM Rabbit mAb (A20936). Western blot was performed from the immunoprecipitate using TSFM Rabbit mAb (A20936) at a dilution of 1:500.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TSFM (P43897). Isotype IgG