быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TRIM24 Rabbit mAb (A20938)
- Описание
- Характеристики
-
Overview
Product name TRIM24 Rabbit mAb Catalog No. A20938 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2920 Background
The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRIM24 (O15164). Sequence TNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQG Gene ID Swiss Prot Synonyms PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA Calculated MW 117kDa Observed MW 117kDa/140kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Mouse testis, Rat testis Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using TRIM24 antibody (A20938) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRIM24 (O15164). Isotype IgG