быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACAT1 Rabbit mAb (A20943)
- Описание
- Характеристики
-
Overview
Product name ACAT1 Rabbit mAb Catalog No. A20943 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2929 Background
This gene encodes a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. Defects in this gene are associated with 3-ketothiolase deficiency, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 328-427 of human ACAT1 (P24752). Sequence APVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQKL Gene ID Swiss Prot Synonyms T2; MAT; ACAT; THIL Calculated MW 45kDa Observed MW 45kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, Hep G2, A549, DU 145, Rat liver, Rat kidney, Rat heart Cellular location Mitochondrion Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ACAT1 antibody (A20943) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ACAT1 Rabbit mAb (A20943) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using ACAT1 Rabbit mAb (A20943) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 328-427 of human ACAT1 (P24752). Isotype IgG