быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
AAMP Rabbit mAb (A20970)
- Описание
- Характеристики
-
Overview
Product name AAMP Rabbit mAb Catalog No. A20970 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2959 Background
The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AAMP (Q13685). Sequence MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLD Gene ID Swiss Prot Synonyms AAMP Calculated MW 47kDa Observed MW 52kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, MCF7, A375, Mouse liver, Mouse testis, Rat liver, Rat testis Cellular location Cell membrane, Cytoplasm 
Western blot analysis of various lysates, using AAMP antibody (A20970) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
Immunofluorescence analysis of MCF7 cells using AAMP Rabbit mAb (A20970) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AAMP (Q13685). Isotype IgG