быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZEB1 Rabbit mAb (A21794)
- Описание
- Характеристики
-
Overview
Product name ZEB1 Rabbit mAb Catalog No. A21794 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53599 Background
This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3). Sequence INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE Gene ID Swiss Prot Synonyms BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1 Calculated MW 124kDa Observed MW 200kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse heart Cellular location Nucleus Customer validation WB(Homo sapiens )
Western blot analysis of extracts of HeLa cells, using ZEB1 antibody (A21794) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human ZEB1 (NP_110378.3). Isotype IgG