быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TREM2 Rabbit mAb (A22134)
- Описание
- Характеристики
-
Overview
Product name TREM2 Rabbit mAb Catalog No. A22134 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55114 Background
This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-161 of human TREM2 (NP_061838.1). Sequence HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR Gene ID Swiss Prot Synonyms PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c Calculated MW 25kDa Observed MW 35-50kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HUH-7 Cellular location extracellular region, plasma membrane, plasma membrane raft 
Western blot analysis of extracts of HUH-7, using TREM2 antibody (A22134) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-161 of human TREM2 (NP_061838.1). Isotype IgG