- 100 T
- 200 T
- 500 T
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb Catalog No. A22153 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51683-ABf647 Background
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2). Sequence LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF Gene ID Swiss Prot Synonyms B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16 Calculated MW 14kDa/33kDa Observed MW Refer to figures Applications
Reactivity Human, Monkey Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Multi-pass membrane protein, Lipid-anchor 
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb(A22153, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb(A22153, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD20 mAb(A22153, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Обезьяна Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2). Isotype IgG







