быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
WEE1 Rabbit mAb (A22275)
- Описание
- Характеристики
-
Overview
Product name WEE1 Rabbit mAb Catalog No. A22275 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57004 Background
This gene encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DNA replication and mitosis by protecting the nucleus from cytoplasmically activated CDC2 kinase.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WEE1 (NP_003381.1). Sequence MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACP Gene ID Swiss Prot Synonyms WEE1A; WEE1hu Calculated MW 72kDa Observed MW Refer to figures Applications
Reactivity Mouse Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location cytoplasm, nucleolus, nucleoplasm, nucleus 
Immunohistochemistry analysis of paraffin-embedded mouse lung using WEE1 Rabbit mAb (A22275) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WEE1 (NP_003381.1). Isotype IgG