быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD51 mAb (A22299)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD51 mAb Catalog No. A22299 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50621-ABf647 Background
The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human CD51 (NP_002201.2). Sequence SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET Gene ID Swiss Prot Synonyms CD51; MSK8; VNRA; VTNR Calculated MW 116kDa Observed MW Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Cell surface, Cytosol, External side of plasma membrane, Extracellular exosome, Filopodium membrane, Focal adhesion, Lamellipodium membrane, Mmicrovillus membrane, Phagocytic vesicle, Plasma membrane, Ruffle membrane 
Flow cytometry:1X10^6 MOLT-4 cells (Low Expression, left) and BeWo cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 BeWo cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, right).

Flow cytometry:1X10^6 MOLT-4 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD51 mAb(A22299, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human CD51 (NP_002201.2). Isotype IgG







