быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb Catalog No. A22311 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55310-ABf647 Background
Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.Immunogen information
Immunogen Recombinant fusion protein containing a sequence within amino acids 1-80 of human CD225/IFITM1 (NP_003632.4). Sequence MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS Gene ID Swiss Prot Synonyms 9-27; CD225; IFI17; LEU13; DSPA2a Calculated MW 14kDa Observed MW Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location plasma membrane 
Flow cytometry: 1X10^6 U-251MG cells (Low Expression, left) and K-562 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained was used as blank control (red line).
Flow cytometry: 1X10^6 K-562 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 5 μl/Test, right).
Flow cytometry: 1X10^6 U-251 MG cells (Low Expression) were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD225/IFITM1 mAb (A22311, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence within amino acids 1-80 of human CD225/IFITM1 (NP_003632.4). Isotype IgG