быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Xanthine Oxidase (XDH) Rabbit mAb (A22335)
- Описание
- Характеристики
-
Overview
Product name Xanthine Oxidase (XDH) Rabbit mAb Catalog No. A22335 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51279 Background
Xanthine dehydrogenase belongs to the group of molybdenum-containing hydroxylases involved in the oxidative metabolism of purines. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Xanthine dehydrogenase can be converted to xanthine oxidase by reversible sulfhydryl oxidation or by irreversible proteolytic modification. Defects in xanthine dehydrogenase cause xanthinuria, may contribute to adult respiratory stress syndrome, and may potentiate influenza infection through an oxygen metabolite-dependent mechanism.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Xanthine Oxidase (XDH) (NP_000370.2). Sequence CIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILK Gene ID Swiss Prot Synonyms XO; XOR; XAN1 Calculated MW 146kDa Observed MW 152kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse lung, Rat lung, Rat liver, Mouse heart Cellular location Cytoplasm, Peroxisome, Secreted 
Western blot analysis of various lysates, using XanthineOxidase(XDH) antibody (A22335) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of Mouse heart, using XanthineOxidase(XDH) antibody (A22335) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Xanthine Oxidase (XDH) (NP_000370.2). Isotype IgG