быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Tryptophanyl-tRNA synthetase 1 Rabbit mAb (A22440)
- Описание
- Характеристики
-
Overview
Product name Tryptophanyl-tRNA synthetase 1 Rabbit mAb Catalog No. A22440 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2687 Background
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl-tRNA synthetase 1 (P23381). Sequence VNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ Gene ID Swiss Prot Synonyms HMN9; WARS; IFI53; IFP53; GAMMA-2 Calculated MW 53kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Cytoplasm 
Immunohistochemistry analysis of paraffin-embedded human placenta using Tryptophanyl-tRNA synthetase 1 Rabbit mAb (A22440) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl-tRNA synthetase 1 (P23381). Isotype IgG