быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human ERG mAb (A22497)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human ERG mAb Catalog No. A22497 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56338-ABf647 Background
This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERG (NP_891548.1). Sequence MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTV Gene ID Swiss Prot Synonyms p55; erg-3 Calculated MW 54kDa Observed MW Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Cytoplasm, Nucleus 
Flow cytometry: 1X10^6 K-562 cells (negative control, left) and MOLT-4 cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human ERG mAb (A22497, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 MOLT-4 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human ERG mAb (A22497, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERG (NP_891548.1). Isotype IgG







