быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD317/BST2 mAb (A22518)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD317/BST2 mAb Catalog No. A22518 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56691-ABf647 Background
Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 49-160 of human CD317/BST2 (NP_004326.1). Sequence NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS Gene ID Swiss Prot Synonyms CD317; HM1.24; TETHERIN Calculated MW 20kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Apical plasma membrane, Cell surface, Extracellular exosome, Golgi apparatus, Multivesicular body, Plasma membrane 
Flow cytometry:1X10^6 A549 cells (negative control, left) and HeLa cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD317/BST2 mAb(A22518, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human BST2 mAb(A22518, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 49-160 of human CD317/BST2 (NP_004326.1). Isotype IgG







