быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human CD44 mAb (A22519)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human CD44 mAb Catalog No. A22519 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52412-ABf488 Background
The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). Sequence AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV Gene ID Swiss Prot Synonyms IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1 Calculated MW 82kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IF/ICC FC Recommended dilution - IF/ICC 1:50 - 1:200
- FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunofluorescence Flow Cytometry Positive samples Cellular location Cell membrane, Single-pass type I membrane protein, Cell projection, Microvillus, Secreted 
Immunofluorescence analysis of A-431 using ABflo® 488 Rabbit anti-Human CD44 mAb (A22519) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and HeLa cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD44 mAb(A22519, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD44 mAb(A22519, 5 μl/Test, right).
-
Key applications Immunofluorescence, Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). Isotype IgG