быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TRβ1/THRB Rabbit mAb (A22560)
- Описание
- Характеристики
-
Overview
Product name TRβ1/THRB Rabbit mAb Catalog No. A22560 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56361 Background
The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Mutations in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH). Several alternatively spliced transcript variants encoding the same protein have been observed for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human TRβ1/THRB (NP_000452.2). Sequence MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEK Gene ID Swiss Prot Synonyms TRb; GRTH; PRTH; THR1; ERBA2; NR1A2; THRB1; THRB2; TRbeta; THRbeta; TRbeta1; C-ERBA-2; THRbeta1; Thrbeta2; C-ERBA-BETA Calculated MW 53kDa Observed MW 53kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2 Cellular location Nucleus 
Western blot analysis of various lysates, using TRβ1/THRB antibody (A22560) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human TRβ1/THRB (NP_000452.2). Isotype IgG