быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb (A22787)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb Catalog No. A22787 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57786-ABf647 Background
Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-111 of Mouse Ly-6A/E (Sca-1)(NP_034868.1) Sequence LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG Gene ID Swiss Prot Synonyms TAP; Sca1; Sca-1; Ly-6A.2; Ly-6A/E; Ly-6E.1 Calculated MW 14kDa Observed MW Refer to figures Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location External side of plasma membrane, Plasma membrane 
Flow cytometry:1X10^6 RAW 264.7 cells (negative control, Left) and C57BL/6 mouse splenocytes (Right) were surface-stained with ABflo® 647 Rabbit anti-Mouse Ly-6A/E (Sca-1) mAb(A22787, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse Ly-6A/E(Sca-1) mAb(A22787, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-111 of Mouse Ly-6A/E (Sca-1)(NP_034868.1) Isotype IgG