быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACVR1B Rabbit mAb (A2279)
- Описание
- Характеристики
-
Overview
Product name ACVR1B Rabbit mAb Catalog No. A2279 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1899 Background
This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACVR1B (P36896). Sequence MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDY Gene ID Swiss Prot Synonyms ALK4; SKR2; ACTRIB; ACVRLK4 Calculated MW 57kDa Observed MW 52kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, HepG2, U-87MG, Mouse brain, Rat brain Cellular location cell surface, cytosol, plasma membrane Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ACVR1B Rabbit mAb (A2279) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat testis using ACVR1B Rabbit mAb (A2279) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using ACVR1B Rabbit mAb (A2279) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using ACVR1B Rabbit mAb (A2279) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using ACVR1B Rabbit mAb (A2279) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACVR1B (P36896). Isotype IgG