быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
α-Actin-1 (ACTA1) Rabbit mAb (A2280)
- Описание
- Характеристики
-
Overview
Product name α-Actin-1 (ACTA1) Rabbit mAb Catalog No. A2280 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1914 Background
The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause a variety of myopathies, including nemaline myopathy, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects with manifestations such as hypotonia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human α-Actin-1 (ACTA1) (P68133). Sequence ITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS Gene ID Swiss Prot Synonyms ACTA; ASMA; CFTD; MPFD; NEM1; NEM2; NEM3; SHPM; CFTD1; CFTDM; CMYP2A; CMYP2B; CMYP2C Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, A-431, RD, C6, Mouse lung, Mouse brain, Mouse heart, Rat heart Cellular location Cytoplasm, cytoskeleton 
Western blot analysis of extracts of various cell lines, using α-Actin-1 (ACTA1) Rabbit mAb (A2280) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of rat skeletal muscle using α-Actin-1 (ACTA1) Rabbit mAb (A2280) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse skeletal muscle using α-Actin-1 (ACTA1) Rabbit mAb (A2280) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human α-Actin-1 (ACTA1) (P68133). Isotype IgG







