быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Zyxin Rabbit mAb (A2298)
- Описание
- Характеристики
-
Overview
Product name Zyxin Rabbit mAb Catalog No. A2298 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1906 Background
Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942). Sequence TQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP Gene ID Swiss Prot Synonyms ESP-2; HED-2 Calculated MW 61kDa Observed MW 78kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples MCF7, Mouse lung Cellular location Cell junction, Cytoplasm, Nucleus, cytoskeleton, focal adhesion 
Western blot analysis of extracts of various cell lines, using Zyxin Rabbit mAb (A2298) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of NIH-3T3 cells using Zyxin Rabbit mAb (A2298) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942). Isotype IgG







