быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
YTHDC1 Rabbit mAb (A22992)
- Описание
- Характеристики
-
Overview
Product name YTHDC1 Rabbit mAb Catalog No. A22992 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC59465 Background
Enables N6-methyladenosine-containing RNA binding activity. Involved in mRNA export from nucleus; mRNA splice site selection; and regulation of gene expression. Located in nuclear speck and plasma membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human YTHDC1 (NP_001026902.1). Sequence MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVS Gene ID Swiss Prot Synonyms YT521; YT521-B Calculated MW 85kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:500 - 1:1000
- IP 1:1000-1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples K-562, U-87MG Cellular location Nucleus 
Western blot analysis of various lysates, using YTHDC1 antibody (A22992) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using YTHDC1 Rabbit mAb (A22992) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using YTHDC1 Rabbit mAb (A22992) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat testis using YTHDC1 Rabbit mAb (A22992) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-71 of human YTHDC1 (NP_001026902.1). Isotype IgG