быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
UGT1A1 Rabbit mAb (A22995)
- Описание
- Характеристики
-
Overview
Product name UGT1A1 Rabbit mAb Catalog No. A22995 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57750 Background
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-Najjar syndromes types I and II and in Gilbert syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of humanUGT1A1 (NP_000454.1). Sequence FENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSH Gene ID Swiss Prot Synonyms GNT1; UGT1; UDPGT; UGT1A; HUG-BR1; BILIQTL1; UDPGT 1-1 Calculated MW 60kDa Observed MW Refer to figures Applications
Reactivity Mouse, Rat Tested applications IF/ICC Recommended dilution - IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunofluorescence Positive samples Cellular location Endoplasmic reticulum, Endoplasmic reticulum membrane, Microsome, Single-pass membrane protein 
Confocal imaging of NIH/3T3 cells using UGT1A1 Rabbit mAb (A22995, dilution 1:200) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.

Immunofluorescence analysis of PC-12 using UGT1A1 antibody (A22995) at dilution of 1 : 200 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of humanUGT1A1 (NP_000454.1). Isotype IgG







