- 100 T
- 200 T
- 500 T
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb Catalog No. A23009 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57915-ABf647 Background
This gene encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes. This protein is a reliable marker for pre-B cells but its expression diminishes during terminal B cell differentiation in antibody secreting plasma cells. The protein has two N-terminal extracellular Ig-like domains separated by a non-Ig-like domain, a hydrophobic transmembrane domain, and a large C-terminal cytoplasmic domain. This protein forms a complex with several membrane proteins including complement receptor type 2 (CD21) and tetraspanin (CD81) and this complex reduces the threshold for antigen-initiated B cell activation. Activation of this B-cell antigen receptor complex activates the phosphatidylinositol 3-kinase signalling pathway and the subsequent release of intracellular stores of calcium ions. This protein is a target of chimeric antigen receptor (CAR) T-cells used in the treatment of lymphoblastic leukemia. Mutations in this gene are associated with the disease common variable immunodeficiency 3 (CVID3) which results in a failure of B-cell differentiation and impaired secretion of immunoglobulins. CVID3 is characterized by hypogammaglobulinemia, an inability to mount an antibody response to antigen, and recurrent bacterial infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-292 of monkey CD19. Sequence PQEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK Gene ID Swiss Prot Synonyms Calculated MW 63kDa Observed MW Refer to figures Applications
Reactivity Human, Monkey Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location membrane 
Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 RRabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, right).

Flow cytometry: 1X10^6 Raji cells were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Raji cells was used as blank control (red line).

Flow cytometry: 1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained Daudi cells was used as blank control (red line).

Flow cytometry: 1X10^6 293F cells(negative control) were surface-stained with ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained 293F cells was used as blank control (red line).

Flow cytometry:1X10^6 Raji cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, right).

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, right).

Flow cytometry:1X10^6 Monkey PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test).The cells were simultaneously stained with FITC Mouse anti-Human CD3 Antibody.

Flow cytometry:1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test).The cells were simultaneously stained with ABflo® 488 Rabbit anti-Human CD27 mAb(A22063,5 μl/Test).

Flow cytometry:1X10^6 Monkey PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test) or ABflo® 647 Rabbit anti-Human/Monkey CD19 mAb(A23009, 5 μl/Test).The cells were simultaneously stained with ABflo® 488 Rabbit anti-Human CD27 mAb(A22063,5 μl/Test).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Обезьяна Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-292 of monkey CD19. Isotype IgG







