быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Tyrosinase Rabbit mAb (A23209)
- Описание
- Характеристики
-
Overview
Product name Tyrosinase Rabbit mAb Catalog No. A23209 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53165 Background
The enzyme encoded by this gene catalyzes the first 2 steps, and at least 1 subsequent step, in the conversion of tyrosine to melanin. The enzyme has both tyrosine hydroxylase and dopa oxidase catalytic activities, and requires copper for function. Mutations in this gene result in oculocutaneous albinism, and nonpathologic polymorphisms result in skin pigmentation variation. The human genome contains a pseudogene similar to the 3' half of this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1). Sequence FAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN Gene ID Swiss Prot Synonyms ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3 Calculated MW 60kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications IHC-P Recommended dilution - IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Positive samples Cellular location Melanosome membrane, Single-pass type I membrane protein 
Immunohistochemistry of paraffin-embedded Human malignant melanoma using Tyrosinase Rabbit mAb (A23209) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1). KO Validated Validated Isotype IgG







