быстрая доставка ~4 недели
Размер
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Mouse IgG2b mAb (A23221)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Mouse IgG2b mAb Catalog No. A23221 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC58677-ABf647 Background
Antigen binding activity, upstream or within phagocytosis, positive regulation of immune response and positive regulation of phagocytosis. Located in the extracellular space. Partial immunoglobulin complex, circulation. It is derived from several human genes, including IGHG1(immunoglobulin heavy constant γ1 (G1m marker)); igg2(immunoglobulin heavy constant γ2 (G2m marker)); And IGHG3(immunoglobulin heavy constant γ3 (G3m marker)).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 97-116 of mouse IgG2b. Sequence SSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNV Gene ID Swiss Prot Synonyms IgG2b; Igh-3; gamma2b；GeneId:16016 Calculated MW 36kDa Observed MW Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Extracellular region, extracellular space, immunoglobulin complex, circulating, plasma membrane 
Flow cytometry:1X10^6 HeLa cells (negative control, Left) and Daudi cells (right) were surface-stained with Mouse anti-Human CD235ab mAb(5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).ABflo® 647 Rabbit anti-Mouse IgG2b mAb(A23221, 5 μl/Test）was used as a secondary antibody.
Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or Mouse anti-Human CD235ab mAb(5 μl/Test, orange line).ABflo® 647 Rabbit anti-Mouse IgG2b mAb(A23221，5 μl/Test）was used as a secondary antibody.
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 97-116 of mouse IgG2b. Isotype IgG