быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TRPV1 Rabbit mAb (A23386)
- Описание
- Характеристики
-
Overview
Product name TRPV1 Rabbit mAb Catalog No. A23386 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57842 Background
Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 725-839 of human TRPV1 (NP_542435.2). Sequence KLLQVGYTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSSRVSGRHWKNFALVPLLREASARDRQSAQPEEVYLRQFSGSLKPEDAEVFKSPAASGEK Gene ID Swiss Prot Synonyms VR1 Calculated MW 95kDa Observed MW 100kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain, Rat brain Cellular location Cell junction, Cell membrane, Cell projection, dendritic spine membrane, postsynaptic cell membrane, synaps 
Western blot analysis of various lysates, using TRPV1 Rabbit mAb (A23386) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 725-839 of human TRPV1 (NP_542435.2). Isotype IgG







