быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Adenylate kinase 4 Rabbit mAb (A2383)
- Описание
- Характеристики
-
Overview
Product name Adenylate kinase 4 Rabbit mAb Catalog No. A2383 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2572 Background
This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Adenylate kinase 4 (P27144). Sequence MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEAL Gene ID Swiss Prot Synonyms AK3; AK 4; AK3L1; AK3L2 Calculated MW 25kDa Observed MW 27kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, HeLa, SH-SY5Y Cellular location Mitochondrion matrix 
Western blot analysis of extracts of various cell lines, using Adenylate kinase 4 antibody (A2383) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using Adenylate kinase 4 Rabbit mAb (A2383) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HepG2 cells using Adenylate kinase 4 Rabbit mAb (A2383) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Adenylate kinase 4 (P27144). Isotype IgG