- 100 T
- 200 T
- 500 T
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human/Mouse BCL6 mAb Catalog No. A23848 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57886-ABflo647 Background
The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1). Sequence ARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS Gene ID Swiss Prot Synonyms BCL6; BCL5; BCL6A; LAZ3; ZBTB27; ZNF51; B-cell CLL/lymphoma 6 Calculated MW 72kDa/78kDa Observed MW Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.02% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Nucleus 
Flow cytometry: 1X10^6 HAP1 cells(Low Expression, left) and Daudi cells(right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human/Mouse BCL6 mAb(A23848, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 A20 cells were intracellularly-stained with ABflo® 647 Rabbit anti-Human/Mouse BCL6 mAb(A23848, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained A20 cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Mouse BCL6 mAb.

Flow cytometry:1X10^6 A20 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human/Mouse BCL6 mAb.
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1). Isotype IgG







