быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A23853)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD262/DR5/TRAILR2 mAb Catalog No. A23853 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61149-ABf647 Background
The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 56-182 of human CD262/DR5/TRAILR2(NP_003833.4). Sequence ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE Gene ID Swiss Prot Synonyms TNFRSF10B; CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9; TNF receptor superfamily member 10b Calculated MW 12kDa/45kDa/47kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.02% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Membrane, Single-pass type I membrane protein 
Flow cytometry: 1X10^6 HEL cells(negative control, left) and Hela cells(right) were surface-stained with ABflo® 647 Rabbit anti-Human CD262/DR5/TRAILR2 mAb(A23853, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD262/DR5/TRAILR2 mAb(A23853, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 56-182 of human CD262/DR5/TRAILR2(NP_003833.4). Isotype IgG







