быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Actin(Plant Specific) Rabbit mAb (A23959)
- Описание
- Характеристики
-
Overview
Product name Actin(Plant Specific) Rabbit mAb Catalog No. A23959 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62861 Background
Actin is an ancient conserved protein that is encoded by multiple isovariants in multi-cellular organisms. There are eight functional actin genes in the Arabidopsis genome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 19-35 of Actin(Plant Specific)(NP_190236.1). Sequence MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAP Gene ID Swiss Prot Synonyms ACT12 Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Widely Range, Oryza sativa, Arabidopsis thaliana Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Oryza sativa, Arabidopsis thaliana Cellular location Cytoplasm, Cytoskeleton 
Western blot analysis of Oryza sativa, using Actin(Plant Specific) Rabbit mAb (A23959) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of Arabidopsis thaliana, using Actin(Plant Specific) Rabbit mAb (A23959) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Другое (Широкий ассортимент), Рис посевной, Резуховидка Таля( Arabidopsis thaliana) Immunogen A synthetic peptide corresponding to a sequence within amino acids 19-35 of Actin(Plant Specific)(NP_190236.1). Isotype IgG