- 100 T
- 200 T
- 500 T
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Mouse CD81 mAb Catalog No. A23980 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61219-ABflo594 Background
Predicted to enable cholesterol binding activity; signaling receptor binding activity; and virus receptor activity. Involved in several processes, including cellular response to low-density lipoprotein particle stimulus; positive regulation of immune response; and syncytium formation by plasma membrane fusion. Acts upstream of or within regulation of cell motility. Located in membrane. Is expressed in several structures, including alimentary system; extraembryonic component; genitourinary system; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD81 (CD81 molecule).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 106-211 of mouse CD81(NP_598416.1). Sequence VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV Gene ID Swiss Prot Synonyms Tapa1; Tapa-1; Tspan28 Calculated MW 25kDa Observed MW Refer to figures Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Multi-pass membrane protein 
Flow cytometry: 1X10^6 Neuro-2a were surface-stained with ABflo® 594 Rabbit anti-Mouse CD81 mAb(A23980, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained Neuro-2a were used as blank control (red line).

Flow cytometry: 1X10^6 HepG2 cells(negative control) were surface-stained with ABflo® 594 Rabbit anti-Mouse CD81 mAb(A23980, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained HepG2 cells were used as blank control (red line).

Flow cytometry:1X10^6 Neuro-2a were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD81 mAb(A23980, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 106-211 of mouse CD81(NP_598416.1). Isotype IgG







