быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Human IL-1β mAb (A24245)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Human IL-1β mAb Catalog No. A24245 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53391-ABflo594 Background
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 117-269 of human IL1β (NP_000567.1). Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Gene ID Swiss Prot Synonyms IL1B; IL-1; IL1-BETA; IL1F2; interleukin-1 beta Calculated MW 30kDa Observed MW Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Cytoplasm, Cytoplasmic vesicle, Lysosome, Secreted, autophagosome, cytosol, exosome Customer validation WB(Rattus norvegicus)
Flow cytometry: 1X10^6 293T cells(negative control, left) and 293T (Transfection, right) were intracellularly-stained with ABflo® 594 Rabbit anti-Human IL-1β mAb(A24245, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293T(Transfection) cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human IL-1β mAb(A24245, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 117-269 of human IL1β (NP_000567.1). Isotype IgG