быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb (A24259)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb Catalog No. A24259 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54260-ABflo594 Background
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (NP_002267.2). Sequence RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL Gene ID Swiss Prot Synonyms K19; CK19; K1CS Calculated MW 44kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Apicolateral plasma membrane, costamere, Cytoskeleton, cytosol, Extracellular exosome, Plasma membrane, Sarcolemma, terminal web, Z disc 
Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and MCF7 cells (right) were intracellularly-stained with ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb(A24259, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MCF7 were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human Cytokeratin 19 (KRT19) mAb(A24259, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (NP_002267.2). Isotype IgG







