быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD369/Dectin-1 Antibody mAb (A24272)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD369/Dectin-1 Antibody mAb Catalog No. A24272 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61646-ABflo647 Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1, 3-linked and beta-1, 6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 66-247 of human CD369/Dectin-1 (NP_922938.1). Sequence TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM Gene ID Swiss Prot Synonyms CLEC7A; BGR; CANDF4; CD369; CLECSF12; DECTIN1; SCARE2; C-type lectin domain containing 7A Calculated MW 5kDa/8kDa/13-27kDa Observed MW Applications
Reactivity human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Cytoplasm, Single-pass type II membrane protein 
Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human CD369/Dectin-1 mAb(A24272, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD369/Dectin-1 mAb(A24272, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 66-247 of human CD369/Dectin-1 (NP_922938.1). Isotype IgG







