быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Mouse CD27 mAb (A24282)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Mouse CD27 mAb Catalog No. A24282 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61612-ABflo594 Background
Predicted to enable cysteine-type endopeptidase inhibitor activity involved in apoptotic process. Involved in negative regulation of apoptotic process and positive regulation of JNK cascade. Acts upstream of or within negative regulation of T cell apoptotic process. Located in external side of plasma membrane. Is expressed in several structures, including femur; hemolymphoid system; intestine; pituitary gland; and reproductive system. Human ortholog(s) of this gene implicated in lymphoproliferative syndrome 2. Orthologous to human CD27 (CD27 molecule).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-182 of mouse CD27 (NP_001028298.1). Sequence PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR Gene ID Swiss Prot Synonyms S152; Tp55; Tnfrsf7 Calculated MW 28kDa Observed MW Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Membrane, Single-pass type I membrane protein 
Flow cytometry: 1X10^6 A20 cells (negative control, left) and C57BL/6 mouse Splenocytes (right) were surface-stained with ABflo® 594 Rabbit anti-Mouse CD27 mAb(A24282, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD27 mAb(A24282, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-182 of mouse CD27 (NP_001028298.1). Isotype IgG







