быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD303/BDCA-2 mAb (A24312)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD303/BDCA-2 mAb Catalog No. A24312 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61690-ABflo647 Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 45-213 of human CD303/BDCA-2 (NP_569708.1). Sequence NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI Gene ID Swiss Prot Synonyms CLEC4C; BDCA2; CD303; CLECSF11; CLECSF7; DLEC; HECL; PRO34150; C-type lectin domain family 4 member C Calculated MW 21kDa/25kDa Observed MW Refer to figures Applications
Reactivity human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Membrane, Single-pass type II membrane protein 
Flow cytometry:1X10^6 293T cells (negative control, Left) and 293T(Transfection) cells (Right) were surface-stained with ABflo® 647 Rabbit anti-Human CD303/BDCA-2 mAb(A24312, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD303/BDCA-2 mAb(A24312, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 45-213 of human CD303/BDCA-2 (NP_569708.1). Isotype IgG







