быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Mouse LAMP1/CD107a mAb (A24364)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Mouse LAMP1/CD107a mAb Catalog No. A24364 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61633-ABflo594 Background
Enables protein domain specific binding activity. Involved in protein stabilization. Located in several cellular components, including cytoplasmic vesicle; sarcolemma; and vacuole. Is expressed in several structures, including 1-cell stage embryo; central nervous system; craniocervical region bone; extraembryonic component; and gut. Orthologous to human LAMP1 (lysosomal associated membrane protein 1).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a(NP_034814.2). Sequence PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE Gene ID Swiss Prot Synonyms P2B; Perk; LGP-A; CD107a; Lamp-1; LGP-120 Calculated MW 43kDa Observed MW Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane 
Flow cytometry:1X10^6 Raw264.7 cells were surface-stained with ABflo® 594 Rabbit anti-Mouse LAMP1/CD107a mAb(A24364, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained Raw264.7 cells were used as blank control (red line).

Flow cytometry:1X10^6 Raw264.7 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse LAMP1/CD107a mAb(A24364, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a(NP_034814.2). Isotype IgG







